PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009599821.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 1007aa    MW: 109809 Da    PI: 5.4954
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009599821.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.3e-29601652152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  XP_009599821.1 601 AEKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 652
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.53591672IPR003035RWP-RK domain
PfamPF020423.4E-26604652IPR003035RWP-RK domain
SuperFamilySSF542771.11E-20911997No hitNo description
SMARTSM006666.1E-23912994IPR000270PB1 domain
PROSITE profilePS5174519.935912994IPR000270PB1 domain
PfamPF005642.5E-16913993IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.7E-22913993No hitNo description
CDDcd064079.61E-32913993No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1007 aa     Download sequence    Send to blast
MSEPEEKITS KNPRPKSKEF SSPPPQQPPH TAMEKESTTM MMDLDIDASW SFDQIFAAAA  60
AVSSNPTSPF LPCSPLWGFS DDIEEKPAGN SFSGALRFSG HPRFGATYTD DPEATTETVS  120
VNADKGRLPS PVLELAPRDY PNGSCIIKER MTQALRYFKE STGERVLAQV WAPVKDAGRY  180
VLTTSGQPFV LDPDCNGLHQ YRTVSLMYMF AADGETGGVL GLPGRVFRLK LPEWTPNVQY  240
YSSKEFPRLD HALHYNVRGT LALPVFEPSG QSCLGVLELI MTSQKINYAA EVDKVCKALE  300
TVNLKSSEIL DHPNTQICNE GRQNALVEIL EILTAVCETY QLPLAQTWVP CRHRSVLADG  360
GGLKKSCSSF DGSCMGQICM STTDVAFYVV DAHMWGFREA CAEHHLQKGQ GVAGRAYASQ  420
KSCFCEDITQ FCKTEYPLVH YARLFGLTSC FAICLRSSHT GNDDYILEFF LPPNSGDYSD  480
QQALLNSLLL TMKQHFRSLS IASGGELEHD WSSVEIIKAS IEEKIDAKPE SVSAPKSLPQ  540
PTRLPNGWTH LDPLGEQQFS VESDVAKGAG SKCGTGEAPN HVSPSDNKPT GKKSERKRGK  600
AEKTISLEVL QQYFAGSLKD AAKSLGVCPT TMKRICRQHG ISRWPSRKIN KVNRSLSKLK  660
CVIESVQGTE GAFTLTSLAP NSFPAAVGSI SWPACASGSN LPSSPLSKPS VFPEEKNEFS  720
NHGTPESHEE AEPSNQMLGG RVTRKEEFTP QNGFLYAEGS HKSRTGSVSR EESAGTPTSQ  780
GSCQGSPSAG NEFSPQNDLV NSPAREACMK AGGSLEAAHQ TTTENNLAAA FLIPRPFIPE  840
RAQEPFGGML VEDAGSSHDL RNLCSAGEAQ VDERVPEYSL PNPPFSDAIA KDPVYVPADT  900
TPQYSAWPEV TFVTIKAAYR EDIIRFRLCL NSGIVKLKEE VAKRLKLELG TFDIKYLDDD  960
LEVVSISCDA DLQECVDISL SSGSSIVRLL VHDIMSNLGS SCESSGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009599821.10.0PREDICTED: protein NLP6-like isoform X2
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLM1A4Z40.0M1A4Z4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000148370.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7